DCNL1_MOUSE Q9QZ73
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZ73
Recommended name：DCN1-like protein 1
EC number：
Alternative names：(DCNL1) (DCUN1 domain-containing protein 1) (Defective in cullin neddylation protein 1-like protein 1) (Testis-specific protein 3)
Cleaved into：
GeneID：114893
Gene names (primary )：Dcun1d1
Gene names (synonym )：Dcun1l1 Rp42 Tes3
Gene names (ORF )：
Length：259
Mass：30097
Sequence：MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYTRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSSMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
Tissue specificity：Highly expressed in testis. Also expressed in brain, heart, liver, skeletal muscle and kidney. In brain, preferentially expressed in the telencephalon ventricular and subventricular zones, albeit at low levels. In adult testis, expressed in cells above seminiferous tubules, but only weakly in spermatogonia. {ECO:0000269|PubMed:10777668, ECO:0000269|PubMed:10831844}.
Induction：
Developmental stage：Expressed in the developing forebrain, midbrain and hindbrain at early stages of neuronal development. {ECO:0000269|PubMed:20563250}.
Protein families：