MAFB_RAT P54842
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P54842
Recommended name：Transcription factor MafB
EC number：
Alternative names：Transcription factor Maf-1 V-maf musculoaponeurotic fibrosarcoma oncogene homolog B
Cleaved into：
GeneID：54264
Gene names (primary )：Mafb
Gene names (synonym )：Maf1
Gene names (ORF )：
Length：323
Mass：35,792
Sequence：MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDGFRSAHHHHHHHHPHPHHGYPGAGVTHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHAAAAATAAGSNGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL
Tissue specificity：Expressed at low levels in a variety of tissues, including liver, muscle and spleen. Strongly expressed in hypertrophic chondrocytes of the femur epiphysis, while expression is very weak in immature proliferating chondrocytes (at protein level). 2 s
Induction：
Developmental stage：Expressed in the cartilage of ribs and limbs, in the eyes and spinal cord at 15 dpc (at protein level). Expressed in the lens epithelium at 13 and 16 dpc; not detected in the fiber cells of the lens. In the eyes, confined in the equator of the lens; not detected in the retina at 15 dpc. In spinal cord, expressed in the ventral part of the dorsal horn and the ventral horn at 15 dpc. Predominantly expressed in postmitotic cells. 2 s
Protein families：bZIP family